SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000309166-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000309166-3
Domain Number 1 Region: 13-127
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.15e-31
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000309166-3
Sequence length 197
Comment RBM4 (Homo_sapiens) RNA binding motif protein 4
Sequence
MYQGHERTGPVSPRPLVKLFIGNLPRKATEQEIHSLFEQYGKVLECDIIKNYGFVHIEDK
TAAEDAIRNLHHYKLHSVNINVEASKNKNKASTKLHVGNISPTCTNQELRAKFEEYGPVI
ECDIVKDYAFTPVAELWCCCHLSAAPATSSSFYGRVGEGYGPESELSQASAAARNSLYDM
ARYEREQYVDRARYSAF
Download sequence
Identical sequences G5CAK7
HGL_H00000309166-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]