SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000309558 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000309558
Domain Number 1 Region: 175-315
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.12e-24
Family Canonical RBD 0.0000702
Further Details:      
 
Domain Number 2 Region: 343-383
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000173
Family Ran binding protein zinc finger-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000309558
Sequence length 566
Comment TAF15 (Homo_sapiens) TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Sequence
DSGSYGQSGGEQQSYSSYGSQGNQGYGQAPQSYSGYGQTTDSSYGQSYGSYSSYGQSQSG
YTQSYGGYENQKQSSYGQQSYNNQGQQHTESSGGQGGRAPSYDQSNYGQQDSYDQQSGYD
QHQSSYDDQSNYNQQHDSYNQNQQSYQSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGG
GRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRPDADSESDNSDNNTIFVQGLGE
GVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAIDWF
DGKEFHGNIIKVSFATRRPEFMRGSGSAGGRRGRGGYRGRGSFQGRGGDPKNGDWVCPNP
SCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGCRGGDRGGYGGDRS
GYGGDRSGGGYGGDRSGGGYGGDRSGGGYGGDRSGGYGGDRGGGYGGDRGGGYGGDRGGY
GGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGGSGGYGGDR
SGGYGGDRSGGYGGDRGGYGGKMGGR
Download sequence
Identical sequences G5B745
HGL_H00000309558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]