SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000313890-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000313890-2
Domain Number 1 Region: 370-550
Classification Level Classification E-value
Superfamily SPOC domain-like 5.49e-42
Family SPOC domain 0.00054
Further Details:      
 
Domain Number 2 Region: 10-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.8e-25
Family Canonical RBD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000313890-2
Sequence length 570
Comment RBM15B (Homo_sapiens) RNA binding motif protein 15B
Sequence
MAEGDQWATRNLFIGNLDHTVSELELRRAFGKHGKHGFIEEVDIKRPARGQGAACALLRF
QDRAAAHRAKVAMSGRVLGRSPIKVGYGKANPTARLWVGGLGPNPSLAALAREFDRFGII
RTIDHIKGDDFAYIQFETLDAAEVACAEMRGFPVGGPHRRLRVGFARAEETRYPPQYLPS
PLPVHRELLEDGYTRHPTLDADLRVRDKTPPYLCLDRDRTFLEGDWTGPRKSADARNSLE
GFSRSVRSRSGERWRGHRDRGLPKPWEDSGEDNRGRTAHCAYEERSWAKGGRQQYDCEVN
HFDAGTKESGSSSLSNSRHGAEEWGHHFHRGAPDSSYGKKTREREGNYWITEAEPKPLEE
PKHETKKLKTLSEYAQTLQLGWNGLLVLKSSCFPTSMYILEGDQGVINGLLRDQTSGSKL
TQLKITQRLRLDQPKFDEVTRRLRQGSSNGYAVLLATQAAPSGAGAEGMPPVEPGLQRRL
LRNLASYLKGKQAAGVISLPVGGAKGRDYQGMLYAFPPCHFSQQYLQSVPVPRTLGEPEE
EHMLIVIVTGTARPKAAFSSTTSASQKQLL
Download sequence
Identical sequences G5C4B4
HGL_H00000313890-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]