SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000314073 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000314073
Domain Number 1 Region: 29-216
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.19e-52
Family Tpt1/KptA 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000314073
Sequence length 252
Comment TRPT1 (Homo_sapiens) tRNA phosphotransferase 1
Sequence
MSSSGGRSREAAGPKGRRASRPRQQDRDVQLSKALSYTLRHGALKLGLPMGADGFVPLHS
LLQLPQFHSFSAEDVQHVVDTNEKQRFTLRPGDPSTGPLIRANQGHSLQVPDLELVPLET
PQALPRMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRRNCEVAVLIN
GPLALADGIPFFCSANGVILTPGDADGFLLPKYFKEALQLCPARKPLSLPGDKETECPSG
PKHSPRGRMIKQ
Download sequence
Identical sequences G5B6F4
HGL_H00000314073 XP_004852593.1.39548 XP_004852594.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]