SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000314649 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000314649
Domain Number 1 Region: 1-471
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-156
Family ALDH-like 0.0000000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000314649
Sequence length 473
Comment ALDH5A1 (Homo_sapiens) aldehyde dehydrogenase 5 family, member A1
Sequence
DPASGAAMASVADCGASEARAAVRVAHEAFCSWRGVSAKERSSLLRKWYDLMMQNKDDLA
KIITAESGKPLKEAQGEILYSANFLEWFSEEARRIYGDIISTPAKERRALVLKQPLGVAA
VITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAQFSASLCLMTFAGCFPLQ
LSNQAGIPSGVYNVIPCSRTKAKEVGEVLCTDPLVSKISFTGSTATGKVLLHHAASTVKR
VSMELGGLAPFIVFDSANVDQAVAGAMASKFRNAGQTCVCANRFLVQKGIHDSFVKKFAE
AIQKSLRIGSGFEEGTTQGPLINEKAVEKVEKQVSDAVSKGATVVTGGKRHPYGRNFFEP
TLLSNVTRDMLCSREETFGPLAPVIKFDTEEEAIAVANAAEVGLAGYFYSRDPAQIWRVA
EQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL
Download sequence
Identical sequences G5BJY3
HGL_H00000314649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]