SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000324287 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000324287
Domain Number 1 Region: 1-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.34e-72
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 384-499
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.71e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 244-349
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 594-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.22e-25
Family Ankyrin repeat 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000324287
Sequence length 762
Comment ACAP2 (Homo_sapiens) ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
Sequence
FRAALEEVEGDVAELELKLDKLVKLCIVMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVV
ETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKEN
ALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVLQSKRRSEILKSMLSFM
YAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQKHSTIQQKDFSSDDSK
LEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQKKFKDNPTVVVEDLRLC
TVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSIATAYREKGDESEKLDK
KSSPSTGSLDSGSESKEKLLKGESALQRVQCIPGNASCCDCGQADPRWASINLGITLCIE
CSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYEAKVEKMGIKKPQPGQR
QEKEAYIKAKYVERKFVDKYSISSSPPEQGKKTVSRGCEEKRLSISKLGPGDPIRSSVQS
SVKSNDSGIQQSCDDGRESLPSTVSASSLYEPEGERQDSSVFLDSKHLNPGLQLYRASYE
KNLPKMAEALARGADVNWANSEENKATPLIQAVLGGSLVTCEFLLQNGANVNQRDVQGRG
PLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANADIVTLLRLARMNEEMR
ESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences G5ALE0
HGL_H00000324287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]