SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331727 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000331727
Domain Number 1 Region: 420-607
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 150-325,355-416
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.3e-43
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331727
Sequence length 949
Comment KCNH7 (Homo_sapiens) potassium voltage-gated channel, subfamily H (eag-related), member 7
Sequence
GSTFICNTHIIPVKNQEGVAMMFIINFEYVTDEENAASPERVNPILPVKAVNRPFNHIKS
SLLGSTSDSNLNKYSTINKIPQLTLNFSDVKTEKKNTSPPSSDKTIIAPKVKDRTHNVTE
KVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIYTAIFTPYSAAFL
LNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEEVVSDPAKIAIHY
FKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVL
MLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYNDSDSSSGPSIKD
KYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSG
TARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVLKGFPECLQADIC
LHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLTALYFLSRGSIEI
LKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQREDLLEVLDMYPEFS
DHFLTNLELTFNLRHESAKADLLLRSQSVNDSEGENCKLRRRRLSFESEGDKDFGKESST
NDPEDSADTIRHYQSSKKHFEEKKSRSSSFISSIDDEQKPLFSGTVDSTPRLGKATGLHF
EETMPTSGRMHTDKRSHSCRDITDMRSWEGEHTRAQPDECSPSALQRAAWGTSETESDLT
YGEVEQRLDLLQEQLNRLESQMTADIQTILQLLQKQTTVVPPAYSMVTAGAEYQRPILRL
MRTSHPTASIKTDRSFSPSSQFPEFLDLEKSKLKSKESLSSGVHLNTASEDNLTSLLKQD
SDVSLELHLRQRKTYLHPIRHPSLPDSSLSTVGILSLHRHVSDPGLPGK
Download sequence
Identical sequences G5AKB1
HGL_H00000331727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]