SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000349041 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000349041
Domain Number 1 Region: 47-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.81e-21
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000349041
Sequence length 161
Comment NRARP (Homo_sapiens) NOTCH-regulated ankyrin repeat protein
Sequence
MPHGEDDEDQTRLFRAMGVGTTQHSIFEAPARSELHHSLEAQQQAKAVLRHFCVRIAPAN
IFSHSQTQRIFQEAVRRGNTRELQSLLQNMTNCEFNVNSVAPEGQTALHQSVIDGNLELV
KLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAK
Download sequence
Identical sequences G5BFZ5
HGL_H00000349041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]