SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357304 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357304
Domain Number 1 Region: 254-349
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000056
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 143-207
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000156
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357304
Sequence length 624
Comment KIAA0907 (Homo_sapiens) KIAA0907
Sequence
MAQPERPTRSRVQNVLPWAQGGAAEQRQGARTRVWAVLTGLESYTCRSWPRALAAAGAEV
TSSGGSPGAAAAAPSGALDAAAAVAAKINAMLMAKGKLKPTQNAAEKLQAPGKGLTSNKS
KDDLVVAEVEINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRP
LYLHVQGQTRELVDRAVNRIKEIITNGVVKAATGTSPTFNGATVTVYHQPAPITQLSPAV
SQKPPFQSGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGS
GCIEPASGREAFEPMYIYISHPKSEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG
YSQPSAISSVPPQPPYYPSNGYQSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPAL
PTGVPPVPTQYPITQVQPPVSTGQAPVKAALPAGPQPQPQPPLPSQPQAQKRRFTEELPD
ERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQLMPPPAFPVTG
IKTESDERNGSGTLPGSHDYPAKKMKTTEKGFGLVAYAADSSDEEEEHGGHKNASSFPQG
WSLGYQYPSSQPRAKQQMPFWMAP
Download sequence
Identical sequences G5ARA9
HGL_H00000357304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]