SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000366829 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000366829
Domain Number 1 Region: 123-214,292-347
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-20
Family Canonical RBD 0.0047
Further Details:      
 
Domain Number 2 Region: 209-237
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000012
Family Ran binding protein zinc finger-like 0.0026
Further Details:      
 
Weak hits

Sequence:  HGL_H00000366829
Domain Number - Region: 754-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00226
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000366829
Sequence length 936
Comment RBM10 (Homo_sapiens) RNA binding motif protein 10
Sequence
RGGRGDRTGRYGATDRSQDDGGETRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQS
AEDSYEASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEEDEEEEE
KASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSHLQDAT
RWMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPKSEAEQ
KLPLGARMDSQALPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENANDTIILR
NLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVVRAAQGGAGQP
GSRPPGTIDGKTINVEFAKGSKRDMASNEGSRINAASVASTAIAAAQWAISQASQGGEGA
WATPEEPPVDYSYYQQDESYGSSQGTDSLYGHGYLKDSLYGHGYLKGTKGPGITGTKGDP
TGAGPEASLESGSDSVSIQAFSRAQPGAAPGLYQQSTAEASSSQGTAANSQSYTIMSPAV
LKSELQSPTHPSSTLPPATSPTTQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNS
QYYYNAQSQQYLYWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKD
MERWARSLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLP
KLASDDRPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEAL
IRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPK
RRKYGSISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRV
RGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEAQ
Download sequence
Identical sequences G5AZF8
HGL_H00000366829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]