SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000369857 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000369857
Domain Number - Region: 195-229
Classification Level Classification E-value
Superfamily Tropomyosin 0.0144
Family Tropomyosin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000369857
Sequence length 331
Comment FAM175A (Homo_sapiens) family with sequence similarity 175, member A
Sequence
EGFLFGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYRLFSFYNSSGEVNKHALKKIL
SRVEKNVVGWYKFRRHTDQIMTFRERLLHRNLQKHLSNQELVFLLLTSSIVTESCSTHQL
EHALYQPQKGLFHRIPLVVTNLGMSEPLGYKTTSGSCTSTGFSRAVKIHSSEFFKEDGSL
KEVHKINEMYASLQEELKDVCNKVEGSEREVEKLIKDVNRLKQEIKKRQQVQIQAAREKN
VQKDPQENIFLCQALQTFFPDCEFLHSCVISLKTRQICESRCNVMHNLEVADKLTLMVEY
THSPEASPARTPQVTKRKAIGPDDGWQVKRA
Download sequence
Identical sequences G5AT11
HGL_H00000369857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]