SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000371180 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000371180
Domain Number 1 Region: 95-333
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-17
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000371180
Sequence length 504
Comment CATSPER2 (Homo_sapiens) cation channel, sperm associated 2
Sequence
LLFSSQTAMDHHARHMHLPRADAIRSRRIDLELFQASGQPVPLFTTREILDPSLQKPLRL
RDQHQQVRFSTKARHLGRVSHAQRLLCRFHVRHNPWFKNLITFLIILNAIVRMITIELLD
STNNSLWPLKLSLEVAVWFILPVFTVEILLKWVASFSLFWKNAWNVFDFTVTLLPLLYEI
LVLGGVTGHPVWLELLSICSVMRCFRLYAQFHQVRVIILALVRTFKSIRFHFMLLLLLFY
IFAVAGVYFFKDYTRSTRQDLVYKEAFLGLPYSLITVFILFTMDHWNALLRDIWKVPEVS
SVISSTYIILWVLLGSIILRNVIISTMANNFRDIRDELDKEMAHLAAQHKADVLKLQILR
RRQNLSFTTLRSSHSKINPREVRRHRMSLDFQEASSEKEFKNSAVEKDLTVSSKLTKESL
IKREESSSSSTTSSSSEYGDTQEAFLPTDQLDWENLVHQNLPELLEMDRDEYTLWPRNLL
LRYLELLEELQYNLEERKELQQLA
Download sequence
Identical sequences G5CA50
HGL_H00000371180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]