SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000379029 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000379029
Domain Number 1 Region: 30-381
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.31e-106
Family Motor proteins 0.00000218
Further Details:      
 
Domain Number 2 Region: 1262-1578
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.77e-53
Family WD40-repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 959-1073
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000706
Family Prefoldin 0.015
Further Details:      
 
Weak hits

Sequence:  HGL_H00000379029
Domain Number - Region: 444-528,578-619
Classification Level Classification E-value
Superfamily ARM repeat 0.0311
Family Exportin HEAT-like repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000379029
Sequence length 1600
Comment KIF21A (Homo_sapiens) kinesin family member 21A
Sequence
MTHVKQVKKVGIERVEQSVPEKEAKNLKAQNQDSQQEQIYIQCIEKLIEGCFEGYNATVF
AYGQTGAGKTYTMGTGFDVNITEEEQGIISRAVKHLFKSIEEKKHTAIKNGLPPPDFKVN
AQFLELYNEEVLDLFDTTRDMDAKNKKSNVRIHEDSTGGIYTVGVTTRTVNTESEMMQCL
KLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQVDAENSTDNKMISESSQMNEFET
LTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRD
SKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQ
INALRSEITRLQMELMEYKTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQET
VDALRTRITQLVSDQANQVLARAGEGNEEISNMIHSYIREIEDLRAKFLESEAVNENLRK
NLTRATSRSPYFSGSSAFSPTILSSDKETIEIIDLAKKDLEKLKRKEKKKKKRLQKLEEN
NREERSLAGKEDYADTDQEKKEEKAALERENNELEVEESQEVSDHEDEEDEEDEDDMEGG
ESSDESDSDSDEKANYQADLANITCEIAIKQKLIDELENSQKRLQTLKRQYEEKLMMLQH
KIRDTQLERDQVLQNLGSVESYSEEKAKKIKSEYEKKLQAMNKELQRLQAAQKEHARLLK
NQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRDH
QLRLLEAQKRNQEVVLRRRTEEVTALRRQVRPMSDKVAGKVSRKLSSSEAPGQDTSSSAA
AVETEASRAGTQQKMRIPVARVQALPTPTANGTRKKYQRKGLISRVFTSKTARMKWQLLE
RRVTDIIMQKMTISNMEADMDRLLKQREELTKRREKLSKRREKMIKESGDGDKNVVNINE
EMESLTANIDYINDSISDCQANIMQMEEAKEEGENLDVTAVINACTLTEARYLLDHFLSM
GINKGLQAAQKEAQIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQD
LDSVPFENLEDSTDEDAPLNSPGSEGSMLSSDLMKLCGEVKPKNKARRRTTTQMELLYAD
SSELASDTSAGDASLPGPLTSAAEGQEIGMNAETSGTAAREKELPPPSGLPSKIGSISRP
SSLPEKKIPEPSPGTRRKAYEKTEKSKGKEQKQSDESDSSLSEVHRGIINPFPASKVIRD
SPLQCVHIAEGHTKAVLCVDSTDDLLFTGSKDRNCKVWNLVTGQEIMSLGSHPSNVVSVK
YCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVSLGDASSASTSRVVAIPSGENQI
NQVALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTGHLGPVMCLTVDHISSGQDLIITGS
KDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDSLFSGSRDNGIKKWDIGQKD
LLQQVPNAHKDWVCALGTVPGHPVLLSGCRGGILKLWNMDTCVPVGEMKGHDSPINAICV
NSTHIFTAADDRTVRIWKAHNLQDGQSSDTGGLGEDVPSY
Download sequence
Identical sequences G5BHF4
HGL_H00000379029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]