SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381167 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381167
Domain Number 1 Region: 1673-1882
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.24e-25
Family Extended AAA-ATPase domain 0.03
Further Details:      
 
Domain Number 2 Region: 1913-2124
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.53e-19
Family ABC transporter ATPase domain-like 0.063
Further Details:      
 
Domain Number 3 Region: 2288-2556
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000277
Family ABC transporter ATPase domain-like 0.095
Further Details:      
 
Domain Number 4 Region: 2630-2751,2780-2837
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000377
Family Type II thymidine kinase 0.093
Further Details:      
 
Domain Number 5 Region: 3111-3220
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000268
Family Tropomyosin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381167
Sequence length 4324
Comment DYNC2H1 (Homo_sapiens) dynein, cytoplasmic 2, heavy chain 1
Sequence
MAGGTGDIRKLFIFTTTQNYFGLMSEAWDQPLLYNCLEINNFLDDGNQMLLKVQRSDAGL
CFSNTIDFGDTKDKVLVFFKLRPEVITDENLHNNILVSSMLESPINSLYQVVRQVFAPML
LKDQKWNRNFDPKLQNLLSELEAGLGIVLRRSDANLSKLKLKEDDTTGILTPSDEFQFWI
EQAHRGNKQISKERASYFKELFETIAREFYNLDSLSLLEVVDLVETTQDVVDDVWRQTEH
EHYPESRMLHLLDIIGGSFGRFVQKKLGTLNLWEDPYYLVKENLKAGISICEQWVIVCNH
LTGQVWQCFVPHPWKNEKYFPETLDKLGKRLEEVLAVRTIHEKLLYFLPASEEKIMCLSR
VFEPFTGLNPVQYNPYTEPLWKAAVSQYEKLIAPAEQKIAGKLKNYISEIQDSPQQLLQA
FLKYKELVKRPSISKELMLERETLLARLVDSVKDFQLDFENRCRGIPGDASGPLSGKNLS
EVVNNIVWIRQLELKIDDAIKTAEALLFDLSGFRSFHRSAKDILDQFKLYEQEQFDDWSR
DIQSGLSDSRSGLSIDANSQIMELDPNDGSLKVHYSDRLVVLLREVRQLSALGFVIPAKI
QQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSEGK
SQITWDNPKELESYIQKLQNAAERLATENRKLRKWHTTFCEKVVILMNIDLLRQQQRWKD
GLQELRTGLTSVEAQGFQASDMHAWKQHWNYQLYKALEHQYQMGLEALNENLPEINIDLT
YKQGRLQFRPPFEEIRAKYYREMKRFISIPNQFRGVGEAGDESIFSIMIDRNASGFLTIY
SKAEDLFRRLSAVLHLHKEWIMIGQVDMETLVEKHLFTVHDWERNFKALKIKGKEVERLP
SIVKVDCLNINCNPVKIVIDDFIQKLFDMLVLSLKKSIQAHLHEIDTFVTEAMEVLTIIP
QSVEEIGDANLQYSKLQERKPEILPLFQEAENKNRLLRTVAGGGLETISNLKSKWDKFEL
MMESHQLMIKDQIEVMKGNVKSRLQMYYQELEKFKARWDQLKPGDDIIETSQHNSLEKNA
KLIKEKKIELDDLEVIRKKLVDDCHHFGLEEPNFSLACNISKDIESCAQIWALYEEFQQG
FQEMANEDWITFRTKTYLFEEFLMNWHEKLRKIEEHSVMTVKLQSEVDKYKIVIPILKYV
RGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVAKASDLKNLNSQAQGEVTI
REALRELDLWGVGAVFTLTDYEDSQSRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKG
FEDKVSIWERKLAELDEYLQNLNHIQRKWIYLEPIFGRGALPKEQTRFNRVDEDFRSVMS
DIKKDNRVTTLTTHAGIRNALLTILDQLQRCQKSLNEFLEACFFKGEKRSAFPRFYFIGD
DDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMKSLEGEVVPLKNKVLLSN
NVEGWLNDLALEMKQTLKQLLKECVTTGQSSQGAIDPSLFPSQILCLAEQIKFTEDVENA
IKDHSLHQIETQLVNKLEHYTNVDTSSEDPENTEAGMLELKLKALILDIIHNIDVVKQLN
HVQVHTTDDWAWRKQVRFYMKSDHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLT
LTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKC
GAWGCFDEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVELNSNSGIFITMNPA
GKGYGGRQKLPDNLKQLFRPVAMSHPDNELIAEVILYSEGFKDAKVLGRKLVAIFNLSRE
LLTPQQHYDWGLRALKTVLRGSGNLLRQLKKNGAEQNASESRVVVQALRLNTMSKFTFAD
CTRFDALIKDVFPGIDFKEVEYDQLSTALKQVFEEANYEIIPNQIKKSLELYEQLCQRIG
VVIVGPSGSGKSTLWRMLRAALCKIGKAVKQYTMNPKAMSRHQLLGHIDMDTREWSDGVL
TNSARQVVREPQDVSSWIICDGDIDPEWVESLNSVLDDNRLLTMPSGERIQFGPNVNFVF
ETHDLSCASPATISRMGMIFLSDEETDLNSLIKCWLRNQPVKYRNNLESWIADYFAKALQ
WVLKQNDYVVETSLIGTVMNGLSHLHGCRDHDQFIINLIRGLGGNLNMKSRIEFTKEVFN
WARESPPDSEKPMNTYYDSSRGQLASYILKKPENLTADDFSNSQTLPVIQTPDMQRSLDY
FKPWLNSDTQQPFILIGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSQHLLQKLSQT
CMVISTNSGRVYRPKDCERLVLYLKDINLPNLDKWGTSTLVAFLQQVLTYQGFYDENLEW
VGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCAVDYPEREQLQTIYAAYLEAVLHKNL
KNHSIWCSSSKIYILAGSMVQVYEQVRAKFTVDEYSHYVFTPCILTQWVLGLFRYDLEGG
SSNHPLDYVLEIVAYEARRLFRDKIVGAKELHLFDNMLTSVFQGDWSSDVLENMADSFYV
TWGARHNVGARPGLGQLLPPHGKPLGKLNSADLKDVIKKGLIHYGRDNQNLDILLFQEVL
EYMSRIDRVLSFPGGSLLLAGRSGVGRRIITSLVSHMHGAVLFSPKISRGYELKQFKNDL
KHVLHLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGKYLCEVPGLYTLEELEPLLLP
LKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANLNFIINCESNPALHKKCQVLWMEG
WSDTSMKKIPEMLFSETDGEEKYSDKKRKEEQKKNSVDPDFLKSFLLIHESCKAYGATPS
RYMTFLRVYSAISSSKKNELLKRQSHLQAGVSKLNEAKALVDELNRRAGEQSILLKTKQD
EADAALQEITVSMQDASEQKTELERLKHKIAEEVDKIEERKNKIDDELKEVQPLVNEAKL
AVGNIKPESLSEIRSLRMPPDIIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATF
DARNIPKEIRESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLE
TEQAGLESNLKKTEDRKRRLEELLNSVGQKVSELKEKFQSRTSEAAKLEAEVGKAQETIK
AAEVLINQLDREHKRWNAQVAEITEELATLPKRAQLAAAFITYLSAAPECLRKTCLEEWT
KSAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQIIGFKSWSRVCPFLIDP
SSQATEWLKTHLKDSRLEVINQQDSNFMTALELAVRFGKTLIIQEIDGVEPVLYPLLRRD
LVAQGPRYVVQIGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLQGQL
LALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLEALATSQGNILENKDLIESLNQ
TKASSGLIQNSLKESYKLQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLAAF
LRLFQRALQSKQDAESTEQRIQTLISSLKHIVYEYICRCLFKADQLMFALHFVRGMHPEL
FQENEWDTFTGVVVGDMLRKADSQQKIRDQIPSWIDQERTWAVATLKIALPSLFQTLCFD
DVALWRTFYHSSMCEQEFPSILAKNVSLFQQVLVVQALRPDRLQSAMALFACKTLGLKEL
SPLPLNLKRLYKETLEIEPILIIISPGADPSQELQELANAERSGECYHQVAMGQGQADLA
IQMLRECAHSGDWLCLKNLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPDFTPILLQ
SSLKITYESPPGLKKNLMRTYESWTPEQISKKDNIQRAHALFSFAWFHAACQERRNYIPQ
GWTKFYEFSLSDLRAGYHIIDRLFDGSKDIQWEFVHGLLENAIYGGRIDNYFDLRVLQSY
LKQFFNSSAVNILNQRNKKNIFPYSMSLPKSCSILDYRAVIEKLPEDDKPSFFGLPANIA
RSSQRMISSQVISQLKILGKSVTAGSKFDREIWSNELSPVLSLWKKLNQNSNLIHQKVSP
PNDQQGSPILSFIMLEQFNAIRLVQSIHQSLAALSKVIRGTTLLSSEVQKLASALLHQKC
PLTWQNKWEGPEDPLQYLRGLVARALAIQNWVDKAKNQALLSDTLDLSELFHPETFLNAL
RQETARAMGHSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENHDDSPSVS
SVLPCFMGWIPQGAYGPYSPDECISLPVYTSAERDRVVTNIDVPCCRNQDQWIQCGAALF
LKNQ
Download sequence
Identical sequences G5BUD1
HGL_H00000381167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]