SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382545-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382545-1
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.14e-39
Family Ankyrin repeat 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382545-1
Sequence length 157
Comment ANKRD29 (Homo_sapiens) ankyrin repeat domain 29
Sequence
MCTMSFKHGTTLLMVASYAGHINCVRELVLQGADINLQKESGKTALFFAAHQDHNDVVRF
LFGFGASTECRTKDGATGLFLAAQGGYLDVIRLLLSSGAKVNQPRQGGTAPLWIASQMGH
SKVVRVILLHGAERDAMQNDGTTALLKAAKTRDIMML
Download sequence
Identical sequences G5ANL1
HGL_H00000382545-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]