SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000385395 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000385395
Domain Number 1 Region: 361-464,577-727
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.08e-49
Family Phosphate binding protein-like 0.0000138
Further Details:      
 
Domain Number 2 Region: 1-347
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.18e-24
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000385395
Sequence length 877
Comment GRID1 (Homo_sapiens) glutamate receptor, ionotropic, delta 1
Sequence
ACDLMTQGILALVTSTSCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEA
YTLASRPPVRLNDVMLRLVTELHWQKFIMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVD
KNISHVFTSLFTTXXXXXXXXXXRDTLRRAILLLSPQGAHSFITEAVETNLASKDSHWVF
VNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQEGYLQMLQ
ISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGL
TGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGL
TLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGYQLH
NTSWNGMIGELISKRADVAISAITVVDFSKRYMDYSVGILIKKPEEKISIFSLFAPFDFA
VWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATLHSAIWIVYGAFVQQGGEGS
VNSMALRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSYGTVRD
SAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVA
VVEYAALTDDDCSVTVTGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKW
WPHTGRCDLTSHSSTQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWNSNQCHQET
PKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPSQALEPTREYQNTQ
LSVSTFLPEQSSHGASRTLSAGPSSNLPLPLSSSATM
Download sequence
Identical sequences G5APF7
HGL_H00000385395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]