SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000386761 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000386761
Domain Number 1 Region: 354-550
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-48
Family cAMP-binding domain 0.0000868
Further Details:      
 
Domain Number 2 Region: 108-353
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.16e-36
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000386761
Sequence length 639
Comment CNGA3 (Homo_sapiens) cyclic nucleotide gated channel alpha 3
Sequence
METRGLARPRRSSFTGPGPSRLSQLICSLRSWAARHLHHEDQRPDAFLERFHGTELMEVS
SRESNAQSSVGSQEQPDRGRGSWPLARNNTNACNNKEEEKKKDAMVVDPSSTLYYRWLTV
IALPVFYNWCLLVCRACFDDLQSEHLTLWLTLDYSADVLYGLDMLVRARTGFLEQGLMVK
DVKRLWKHYTKTLQFKLDMLSLVPTDLAYLKLGMSYPELRFNRLLKFSRLFEFFDRTETR
TNYPNVFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISKPEYGRLSRKYIY
SLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNASRAEFQ
AKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHL
DTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGRLAVVADDG
VTQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALIEYPEA
KKALEEKGRQILMKDNLIDEDLARAGVDPKDIEEKVEHLESSLDTLQTRFARLLTEYSAT
QMKVKQRLSQLESWVNICGSSLASSEAQGVAAEIEDKQQ
Download sequence
Identical sequences G5BMT8
HGL_H00000386761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]