SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000389365 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000389365
Domain Number 1 Region: 219-310
Classification Level Classification E-value
Superfamily TAFH domain-like 1.1e-29
Family TAFH domain-like 0.0000427
Further Details:      
 
Domain Number 2 Region: 615-663
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000251
Family TBP-associated factors, TAFs 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000389365
Sequence length 822
Comment TAF4B (Homo_sapiens) TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
Sequence
APAAAPPVRVESTPLALGAVTKSPGAVCVESPAPQPLRSPLVTKVAPVCALPKLSGGPRL
PAPQILTVKAPATATIQLPANLQLPPGTVLIKSNSGQLMLVSPQQGVTRADMASTVTSRP
AVPVNTQTVKICTVTNSSSQVMKNVAVAPVKTLAQRGATVAPAVPNPSSVQPVSLPASVA
SVTAVKPVKPSVLGASSAPSSVPSSRADSLAALQTDLSPAMVENVKKCTNFLAMLIKLAC
HGSQSPEMGKSEKELVEQLLDAKIEVEEFTKKLYIELKSSPQPHLVPFLKKSVIVLRQLL
PDSQSFIQQCVQETSSEFVVGTRTPTVTAPPVVTAASSSAQTEKPIIVSAATVPTPVSVQ
TLNPLAGLEGAKTGLVTLHSMGPAAVPGRTTAGTILLQTSKPLFTSVPNAVTTVSLQPEK
PVVSGSAVTLALPSVTFGEKSPASLCLPPVKTVAASAGTMLDKPVIRTPVQIKLGQPGAL
LSQPVGIPSGVKVKQLVVQQPSGGLGKQGTTASHPSALTIQKSAEKIPVNTVVPTTSILK
QITLPGNKILSLQASTAIQKNKIKENGTTGFRDEDDINDVTSMAGVNLSEENACIVATNS
ELVGTLIQSCKDEPFLFIGALQKRIVDIGKKHDITEFNSDAVNLISHATQERLRGLLEKL
TTIAQHRMTTYKASENYILSSDTKSQLKFFEKLDQLEKHRKDLEEREMLLKAAKSRSNKE
DPEQLRLKQKAKELQQLELAQIQHRDANLTALAAIGPRKKRPLEPGSEGSKDSLACGTSS
LTATKQLLRPRITRICLRDLIFCMEQEREMKYSRALYLALLK
Download sequence
Identical sequences G5BJS2
HGL_H00000389365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]