SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000406620 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000406620
Domain Number 1 Region: 221-488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-76
Family Protein kinases, catalytic subunit 0.00000000441
Further Details:      
 
Domain Number 2 Region: 113-255
Classification Level Classification E-value
Superfamily SH2 domain 1.01e-37
Family SH2 domain 0.00000299
Further Details:      
 
Domain Number 3 Region: 51-137
Classification Level Classification E-value
Superfamily SH3-domain 1.3e-20
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000406620
Sequence length 499
Comment BLK (Homo_sapiens) B lymphoid tyrosine kinase
Sequence
MGLLSSKRQVTEKGKGWSPVKASSRSQGPPPLPPLVVFNHLTPPPPDEHPDQEEHYVMAL
YDYTAVSDRNLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVAPVETLEVEKWFF
RSISRKDAERRLLAPMNKAGSFLVRESETTEGSFSLSVKDVTAQGDIVKHYKIRSLDEGG
YYISPRTTFPSLQALVQHYTKKGDGLCQMLTLPCASVAPQNPWAQDEWEIPRQSLKLVRK
LGSGQFGEVWMGYYKNNVKVAIKTLKEGAMSPEAFLGEANLMKTLQHERLVRLYAVVTKE
PIYIVTEYMARGCLLDFLKTEEGSRLSLPRLIDMSAQIAEGMAYIEHMNSIHRDLRAANI
LVSEALCCKIADFGLARIVDSEYTAQEGATFPIKWTAPEAIHFGVFTIKADVWSFGVLLM
EIVTYGRVPYPGMSNPEVIRSLERGYRMPRPDSCPPALYRDVIAECWRARPEERPTFEFL
QSVLEDFYTATEAQYELQP
Download sequence
Identical sequences G5AMF8
HGL_H00000406620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]