SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000409872-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000409872-2
Domain Number 1 Region: 113-203
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.83e-34
Family SCAN domain 0.0000932
Further Details:      
 
Domain Number 2 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 593-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 239-293
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 515-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Weak hits

Sequence:  HGL_H00000409872-2
Domain Number - Region: 1-26
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00157
Family KRAB domain (Kruppel-associated box) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000409872-2
Sequence length 666
Comment ZNF274 (Homo_sapiens) zinc finger protein 274
Sequence
MLENYKNLLSVEHQLSKPDVVSQLEEAEDFWPVERDILQHTIPECPGAEAPLDSQLSPVP
TENPLVNIKVVEVLTLNQEVAGPRNAQIQALYAEDSGLTTDILRKPAQQLRTYPADPEVA
HQKFRQFQYEEAMGAWEAVAQLRELCQQWLQPKVHSKEQILELLVLEQFLGALPGKFRTW
VELQHPEDCQAAIALVEDVISMSKEGALPSQVSACFPKATTQQQRKEKDTAILPVAELPE
EPVTFQDVSVDFSQEEWGLLGPVQRTEYHDVMLETLGNLVSVGWETAAENKELIPDSNVP
AEEPIYDPKVNELSREGTQPSALEDLLQDGITEVLHAAFQEEEFAEDKPIPQKHLTENPE
SKADPGLDTSQTSPQKIPPRKCFRKLLSQCKSVTHSSHIKDHQKGYEPGKARDSIGHMSQ
SSHVKVQQKGCEWGKAGESSGQVTQHSQVKLHRKGCEPGRAGESSGLVIQNSHVKARQKP
SGQNKAGESNGSKKTVGQRVPQVMFIKIHSGSQICRCSVCGKLFRNPRYFSVHKKIHTGE
KPYVCQDCGKAFVQSSSLTQHQRVHSGERPFQCQECGRTFNDRSAVTQHLRTHTGAKPYA
CQDCGKAFRQSSHLTRHHRTHTGERPYVCHKCGKAFTQSSHLIGHQNTHGRRKHKRKHKK
QPPPAS
Download sequence
Identical sequences HGL_H00000409872-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]