SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000410257 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000410257
Domain Number 1 Region: 1202-1357,1396-1475
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.12e-42
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1526-1776
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4e-35
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 714-861,895-942
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.16e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 134-276,352-421
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-28
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000410257
Sequence length 2017
Comment SCN5A (Homo_sapiens) sodium channel, voltage-gated, type V, alpha subunit
Sequence
MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQAQGSATSQETHEGLPEEEAPQPQLDLQA
SKKLPDLYGNPPRELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATKALYILSPFHPV
RRAAVKILVHSYPLRMLIMCTILTNCVFMAQHDPPSWTKYVEYTFTAIYTFESLVKILAR
GFCLHAFTFLRDPWNWLDFSVIVMAYVSENIKLGNLSALRTFRVLRALKTISVIPGLKTI
VGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTALNDTNGSVEAEGL
VWESLDLYLNDPVNYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFA
WAFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQ
NQATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLAPVTNHERRSKRR
KRMSSGTEECGDERFPKSDSEDGPRAMNHLSLSRTSVKPRSSRGSIFTFRRRDLGSETDF
ADDENSTAGDSESHRTSLLVPWPLRRPSAQGQPSPGASAPSHVLNGKRNSTVDCNGVVSL
LGAGDTEAMSPGSRLLRPMMLERPPDTTTPSEELGGAQMLTPQAPCADGFEEPGARQRAL
SAVSVLTSALEELEESHRKCPPCWNRFAERYLIWECCPLWMSIKQKVKFVVMDPFADLTI
TMCIVLNTLFMALEHYNMTTEFEEMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQGWNI
FDSIIVILSLMELGLSRMGNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALGNLT
LVLAIIVFIFAVVGMQLFGKNYSELRHRISDSGLLPRWHMMDFFHAFLIIFRILCGEWIE
TMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDGEMNNLQL
ALARIQRGLRFIKRTTWDFCCGLLRRRPKKPAALAPRSQLPNCMASPSSPPPPEVEKAPP
ARKETRFEEGKCPGQGAPGEPEPVCVPIAVAESDTDDQEEDDENSLATEEESSKQESQPV
SDGPEPPQEPRAWSQGSETTSWEAEARASQADWRQQRKAEPQAPGCSETHEDSYSEGSTA
DMTNTADLLEQIPDLGEDVKDPEDCFTEGCIRRCPCCAVDTTQSPGKVWWRLRKTCYRIV
EHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLKWVAYG
FKKYFTNAWCWLDFLIVDVSLVSLVANTLGFSEMGPIKSLRTLRALRPLRALSRFEGMRV
VVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNNKS
ECESFNMTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQWEY
NLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKIRGQDIFMTEEQKKYYNAMKKLG
SKKPQKPIPRPLNKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKVNILSK
INLLFVAIFTGECIVKMTALRHYYFTNSWNIFDFVVVILSIVGGNLCSNPLLHFKNWVIF
LLLRFRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFA
YVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNGSRG
NCGSPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEK
FDPEATQFIEYSALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKR
VLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATVIQRAFRRHLLQRS
VKHASFLFRQQVGSGGLSEEDAPEREGLIAYMLNENFSRQDRPPSSSSISSTSFPPSYDS
VTRATSDNLQVRVSDYSHSEDLADFPPSPDRDRESIV
Download sequence
Identical sequences G5C5P1
HGL_H00000410257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]