SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000415034 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000415034
Domain Number 1 Region: 2400-2685
Classification Level Classification E-value
Superfamily BEACH domain 1.07e-112
Family BEACH domain 0.0000000224
Further Details:      
 
Domain Number 2 Region: 2801-3065
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.59e-31
Family WD40-repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 2274-2360
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-20
Family PreBEACH PH-like domain 0.0062
Further Details:      
 
Domain Number 4 Region: 623-773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000026
Family Laminin G-like module 0.052
Further Details:      
 
Weak hits

Sequence:  HGL_H00000415034
Domain Number - Region: 1175-1209,1329-1433,1467-1505,1607-1652,1817-1892,1925-1984
Classification Level Classification E-value
Superfamily ARM repeat 0.000158
Family Armadillo repeat 0.083
Further Details:      
 
Domain Number - Region: 359-386,419-552
Classification Level Classification E-value
Superfamily ARM repeat 0.000269
Family Leucine-rich repeat variant 0.064
Further Details:      
 
Domain Number - Region: 998-1093
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00823
Family Laminin G-like module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000415034
Sequence length 3094
Comment NBEAL2 (Homo_sapiens) neurobeachin-like 2
Sequence
MGSWERGPQRLTFQLPVLPRWLHPLCSAVTPVPPVSPSVPLHLSTPCPSPALCTPSPHPL
QKDLGYLQQWLKAFVGTFEKSISLSSLEPRRPEEAGAEVPLLPLDALHVLAEQLDHRDLG
QALLLLKLFIVLCRNLENVEAGWGQVLLPRVLSLLTGLVAELKGHPPPREDQGAQLESVA
LHALLLCEGLFDPYQTWRRQHSGEDISSKEKSKYKFPPAPLPRDFSAFFQDTLWDADRLP
PVLLLRLIHLFGAVLAGGKENGQMAVSASSVQGLLGVVRDWGRRPAQDARLVPLALEALV
GAVHVLHASRTPPRGPELRTLLEGYFRVLNADWPASPSSGPKEALVALRVSMLDAIPLML
ACEDRPVLQATFLSNNCFEHLIRLIQNSKLYLQARAPPEGDSDLATRLLTEPDVQKVLDQ
DTDAIAVHVVRVLTCIMSGSPSAKEVFKERIGYLQLQEVLQSHGPPTHRLLQELLNMAVE
GDHSMCPPPPIRNEQPVLVLMQWLPALPTAELRLFLAQRLRWLCDSCAASRATCVQAGLV
GSLLETLNTGSGLGARCQEQLLALLQALGRVSLRPLELRRLLRPPSWLDLDGAEAERARH
AGAVIRALSGMARHQGPTRALRYFDLTPSMAGIMVPPVQRWPGPGFSFHAWLCLHPTDPA
PAPVPARPLQRKQLYSFLSSSGLGFEAFFTAAGTLVVAVCTRKEYLTMSLPEVSFADSAW
HCVAIVHVPGRRPFSQNLLHVYKDGHLVKTAPLRCPCLSEPFSSCCIGSAGHRTTTTTLG
LPEPPVPTALAHTYPSLTRSQSVPASTGLGWGSGLVTPLQEGSISSTLAGTQDMRWGSPT
SLEGELGTVAIFHEAVQAAALRTLCALGPNEPAPFKPEGELHDLGVKLLLHYSPQACKNN
ICLDLSPSHTLDGRLTGHRVETWDVKDVVNCVGGMGALLPLLDRVAAQPQEAEAGPAEAH
DLVGPELTSGHNTQGLLLPLGREQEEVGITSLPVPSFFSSSGLGFEAFFTAAGTLVVAVC
TRKEYLTMSLPEVSFADSAWHCVAIVHVPGRRPFSQNLLHVYKDGHLVKTAPLRCPCLSE
PFSSCCIGSAGHRTTTTTLGLPEPPVPTALAHTYPSLTRSQSVPASTGLGWGSGLVTPLQ
EGSISSTLAGTQDMRWGSPTSLEGELGTVAIFHEAVQAAALRTLCALGPNEPAPFKPEGE
LHDLGVKLLLHYSPQACKNNICLDLSPSHTLDGRLTGHRVETWDVKDVVNCVGGMGALLP
LLDRVAAQPQEAEAGPAEAHDLVGPELTSGHNTQGLLLPLGRSSEERMEKNAVAAFLLML
RNFLQGHTGNQESLVQCQGPAIVGALLRKVPSWGMDMNVLMSAQLLIEQVASESRGPLLY
LLYQHLLLNFHLWTLSDFAVRLGHIQYMSSIIREHRQKLRRKYGVQFILDSLRTHYGPQR
ERPLVVDDLRTVQTSLLGLAREFLVRSSSPEDLQVLLSFLAAMGDDSQVVGVLDLLLGLL
QASSAQDFLAVSLLEPGNLEVLLALLVRPGSLPLLPDRVCKILLRLQQNEGLPERSRQRL
RLRDSGFLGLAACLPEGTVSPQLCQGLYRLLLGADGLNISDLLAVVQLSLQTDLSVRLDI
CRQLFHLIYRQPDVVRLLARQAGWQDVLTRLYVLEAVAASGAPPLAPELPTSPEPGLPPS
STESPVDLSDVFLPSDSPGPDPDAFYQALSPFCTPFDLVLERASMGSGTTAVSGSSSGTL
TPASQPGTPSPLDGPRPFPAAPGRHSSSLSNVLEDGSLPTVSGDNASNTSNPQQTPEEEL
CNLLTNVLFSVTWRGVEGSDEAAWRERGQVFSVLTQLGASATLVRPPDCIKRSLLEMMLE
SALADIKEAAPGALASLTQQVLWLLRLLQDFLCAEGHGNQELWSEKLFEGVCSLLDRLGA
WPHLANSTAELREMAQVGLRLVLGYILLEDPQLHAQAYVKLHMLLQTAVPTGREEACYVL
SKLEAALGRALLASQEEGAPEGAQPLAAATATASERCSWLVPLVRTLLDRAYEPLGLQWG
LPSLPPTNGSPTFFEDFQAFCATPEWRQFIDKQVQPTMSQFEMDTYAKSHDLMSGFWNTC
YDMLMSSGQRRQRERTHSRQAFQELVLEPAQRRARLEGLRYAAALKQQAAQHSVALLHWG
ALWRQLSSPCGAWALRDPPTPHWKLSSAETYSRMRLKLVPNHHFDPHLEASALRDNLGEV
PLAPTEEASLPLAMTKEAKVSTRPTEQQEDELEEDELAGLETPMEAAELDEQREKLVLSA
ECQLVTVVAVVPGLLEVTTQHVYFYDGSAERVETEEGIGHDFRRPLAQLREVHLRRFNLR
RSALELFFIDQSNYFLNFPCRGTGTAASSPSQAPRAQPRTPVPHTQVRNQVYSWLLRLRP
PAQGYLSSRSPQEMLRASGLTQKWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLQ
DYVSPTLDLSNPAVFRDLSKPIGVVNPKHAQLVREKYESFEDPAGTIDKFHYGTHYSNAA
GVMHYLIRVEPFPSLHVQLQTWQARLESPADVKELIPEFFYFPDFLENQNGFDLGCLQLT
NEKVGNVVLPPWASSPEDFIQQHRRALESEHVSAHLHEWIDLIFGYKQRGPAAEEALNVF
YYCTYEGAVDLDHVADERERKALEGIISNFGQTPCQLLKEPHPPRLLAEEAAQRLARLDT
NSPSLFQHLDQLKAFFAEVVSDGMPLVLALVPHQQPHSFITQGSPDLLVTVSANGLLGTH
NWLPYDRNINNYFSFSKDPTIGNPKMQRLLSGPWVPGSGVSGQALAVAPDGKLLFSGGHW
DGSLRVTALPRGKLLNQLSRHLDVVTCLALDTCGIYLISGSRDTTCMVWRLLQQGGLSAG
LAPKPVQVLYGHEAAVSCVAISTELDMAVSGSEDGTVIIHTVRRGQFVAALRPPGAALPG
PVSHLGLGPEGQIVVQSSTWERPGAQVTHALHLYSVNGKLRASLPLAEHPTALAVTEDFV
LLGTAQCTLHILHLNKLLPAAPPLPMKVPIRSVALTKERSHVLVGLEDGKLIVVGAGQPS
EVRSSQFARKLWRSSRRISQVSSGETEYNPCEAR
Download sequence
Identical sequences G5ANQ7
HGL_H00000415034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]