SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000419023 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000419023
Domain Number 1 Region: 88-507
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.29e-120
Family Pyridoxal-dependent decarboxylase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000419023
Sequence length 561
Comment SGPL1 (Homo_sapiens) sphingosine-1-phosphate lyase 1
Sequence
MLKNFEPYFEILEAYSTKAKNYVNGYCTKYEPWQLIAWSVLWTLLIVWAYGFIFQPESLW
SRFKKKFFRLVRKMPFLGKKIQKELDKITEDLGKHLQYLKVDKDYVKALPAQGLSTTAVL
ERLKEYSSMDGIWQEGKASGAVYSGEEKLTELLVQAYGNFAWSNPLHPDIFPGLRKLEAE
IVRMACSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVVPVSAHAAFDK
AASYFGMKMVRVPLNKMMEVNVRAMRRAISKNTAMLVCSAPQFPHGVIDPIPEVAKLAIK
YKIPLHVDACLGGFLIVFMEKAGYPLEKPFDFRVEGVTSISADTHKYGYAPKGSSVVLYR
NKKYRKYQFFITTDWPGGIYASPSIAGSRPGGIIAACWATLMHFGENGYVEATKQIIKTA
RFLRSELENIKGIFIFGDPQLSVISLGSHDFDIYRLSNLMTAKGWNLNQLQFPPSIHICI
TLVHTRKRVAIQFLKDVRESVTQIMKNCKAKVTGMGAIYGMSQTIIDRNLVAEISSVFLD
SLYSTDTVTQGSQMNGSPKPR
Download sequence
Identical sequences G5B1A3
HGL_H00000419023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]