SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000420270-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000420270-2
Domain Number 1 Region: 82-262
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-42
Family Protein kinases, catalytic subunit 0.0025
Further Details:      
 
Domain Number 2 Region: 333-422
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.42e-18
Family Canonical RBD 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000420270-2
Sequence length 435
Comment UHMK1 (Homo_sapiens) U2AF homology motif (UHM) kinase 1
Sequence
MPNQPAADRKVCRLCTKVTSCAEHTESACALAAIHWTPTTTPLLWPLLCTATWFHTTKMQ
MTPDHRTTVLGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCL
LLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAE
NECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLG
IILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKRWPGLCR
VPSSNYRTRNKYCSDNGVMFFFFFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVV
EDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFY
PLSAYKRGYLYQTLL
Download sequence
Identical sequences G5BU48
HGL_H00000420270-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]