SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_M00000038256 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_M00000038256
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-25
Family Canonical RBD 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_M00000038256
Sequence length 187
Comment Rbm4b (Mus_musculus) RNA binding motif protein 4B Gene
Sequence
MVKLFIGNLPREATGQEIRSLFEQYGKALEYDVIKNYGFVHMEDETAAEDAIHNLHRYEL
HGVNINVEASKNKGKASTKLHVGNVSPTCTNKELKGKCAEYGPFMECDMELLPPPLQVLL
QLPLHITGGIGAPCVALQAQSPLLEKARVPGMSVSCPKLLQPAGIPLNDMARYEQEQYAD
RAQYSAF
Download sequence
Identical sequences G5ASG6
HGL_M00000038256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]