SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_R00000006780 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_R00000006780
Domain Number 1 Region: 13-49
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000537
Family Canonical RBD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_R00000006780
Sequence length 140
Comment Zcrb1 (Rattus_norvegicus) Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (U11/U12 small nuclear ribonucleoprotein 31 kDa protein)(U11/U12 snRNP 31 kDa protein)
Sequence
MSGGLAPSKSTPYVSNLPFSLTNNDLYRIFSKYGEVVKVIIMKDKDTRKKNVSLQRTKKK
KKKTAKPEEIEDAAESEDEGEDPALDSLSQAIASQQAKIEEQNEWKPSAGGPEGPQTIHG
AHILIRGFTAPEDKEEHTLQ
Download sequence
Identical sequences G5APE0
HGL_R00000006780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]