SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402496691|ref|YP_006555951.1| from Wolbachia endosymbiont of Onchocerca ochengi str. Adamawa_Cameroon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402496691|ref|YP_006555951.1|
Domain Number 1 Region: 3-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.58e-104
Family AAT-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|402496691|ref|YP_006555951.1|
Sequence length 397
Comment aspartate aminotransferase [Wolbachia endosymbiont of Onchocerca ochengi]
Sequence
MLELAKRMSLIKLSPTIAVTDKVNRLKSQGKEICVLAAGEPDFDTPGHIKKAAIQAINEG
KTKYTAVDGTRELKGAIIDKLKRDNDLEYTPSQICVGAGAKQVLFNLLMATINPEDEAVI
PAPCWVSYVDMVSFFGGLPVMAECKENFKLTSELLRSKITEKTKWLILNSPNNPAGVVYT
YDELKKIAQILLEHPHVNIITDDIYEHIVYDGKFFTIAQVEPRLYDRVFVVNGVSKAYAM
TGWRIGYVAGRSDVVKAISILQSQSTSNPNSIAQAAAVEALNGNHDFLKERIKIFKNRRD
FVAEKLGSVPGLSVFIPQGAFYLFISCENLLGKSTKNGKVINNDLDFAEYLLEDHLVAVI
PGVAFSLKNFIRVSYATSQEQLEIGCNSIVKACEMLS
Download sequence
Identical sequences I7IAC1
WP_014868919.1.68585 gi|402496691|ref|YP_006555951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]