SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402496693|ref|YP_006555953.1| from Wolbachia endosymbiont of Onchocerca ochengi str. Adamawa_Cameroon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402496693|ref|YP_006555953.1|
Domain Number 1 Region: 13-425
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.42e-173
Family GABA-aminotransferase-like 0.00000000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|402496693|ref|YP_006555953.1|
Sequence length 425
Comment glycineserine hydroxymethyltransferase [Wolbachia endosymbiont of Onchocerca ochengi]
Sequence
MASVSEEVFIFKKGLRFSDSEVYQSIEKELQRQRSQLQLIASENFASRAVMEAQGSFLTN
KYAEGYPGKRYYCGCEYVDEVENLAIKRLCKLFGVKFANVQPHSGSQANQAVFASLLSPG
DAILGLSLSCGGHLTHGATPSLSGKWFKSIQYTVRRDTYLLDMDEIEELALEHKPKLIIA
GASAYPRRINFKRFREIADKISAYLLADIAHYAGLIAVGEYPSPTEYAHVITSTTHKTLR
GPRGGVIMTNDEVLHKKIQSAVFPGLQGGPLMHVIAAKAVAFKEALAPEFKTYSKKVIEN
AKALAQALKEYGLNIVTGDTDSHMVLIDLRPQKLTGKGVVDSLERAGIICNKNSIPFDTE
KTTITSGLRFGTAAETTRGLEAKNFKEIAELINKVIQGLISGDSSNVEKVVKDKVEKICN
NFPIY
Download sequence
Identical sequences I7ITQ2
gi|402496693|ref|YP_006555953.1| WP_014868921.1.68585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]