SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402496902|ref|YP_006556162.1| from Wolbachia endosymbiont of Onchocerca ochengi str. Adamawa_Cameroon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|402496902|ref|YP_006556162.1|
Domain Number 1 Region: 28-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.52e-87
Family Cystathionine synthase-like 0.00000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|402496902|ref|YP_006556162.1|
Sequence length 399
Comment cysteine sulfinate desulfinasecysteine desulfurase [Wolbachia endosymbiont of Onchocerca ochengi]
Sequence
MYSFNDKRSLYNSVTNKPLSSFFLENSNYIYADYNATSPISDGVRKSILEVLSKQILNPS
SLHRKGQETRKILQDARDAVCGIIDVSSDKEIVFTSGATEANNLVMRGVTGFQYVVSAIE
HPSILNSAHNPHIIPVNQEGIIDLLELEKILSKLKGNKVIVSVMMANNETGVVQPIREIA
EIAHKFGAICHTDAAQSVGKIKVNMENLGVDLLTLSAHKFGGIAGSGVLVFNKNLTIKPI
IVGGGQEKGLRGGTENVVAIAGLSAALQSVPDLLSKMNEIKKLRDQLESKLLNLVSSIKI
FGKNSKRLPNTSFVYMPGVKSDVQLMHFDLNNIAVSNGSACSSGKIEPSYVLLAMGATKE
QANCSVRISIGPQNKPQDIKKIVDCWYDIYKKNTLNMYK
Download sequence
Identical sequences I7JEX4
gi|402496902|ref|YP_006556162.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]