SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392423529|ref|YP_006464523.1| from Desulfosporosinus acidiphilus SJ4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392423529|ref|YP_006464523.1|
Domain Number 1 Region: 7-233
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.96e-55
Family PP-loop ATPase 0.00013
Further Details:      
 
Domain Number 2 Region: 389-463
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.4e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 213-309
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000837
Family MesJ substrate recognition domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392423529|ref|YP_006464523.1|
Sequence length 471
Comment tRNA(Ile)-lysidine synthetase [Desulfosporosinus acidiphilus SJ4]
Sequence
MFEKLRTYILPELIPRDSRILVAVSGGPDSMALGHILWRYMHEDSTRGISLVITHVHHGV
RKESDQELELVQQMADLWEIPCLTHRFDSKGYAHDMGQSFQEAAREWRYARWQEDMRKEE
CTLLATAHHLGDQAETILYRILRGSGTAGLAGIYPSKDSIIRPLLTFTKEDIFRYCELEK
LPYAIDQSNHQPVYVRNRIRLELIPSLERDYNPRLKEALGRMGELLRWDQDYLVQQMKKA
WDLYALKSQTDAVGLRLEAFKEPEAILSRLLRQAAMLVSQEPRGLSYTYVAKIMSSRGKP
GWSQELPGLTVKISEEGIWFYNKAQAIEKESILSFSDIPLQLGTRFEIPGYGAEIALLTE
EEFMLVKETPQDVLSEIVIFDKELLTQTRDRLVCRTRQQGDKMWLPGVGHKSLKKIFQEA
KINSSARNNVPLVAVGNEVLWIPNLRQSGLWRPKKNAPKVYCVMIATNWEF
Download sequence
Identical sequences I4D067
gi|392423529|ref|YP_006464523.1| WP_014825207.1.101568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]