SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392423576|ref|YP_006464570.1| from Desulfosporosinus acidiphilus SJ4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392423576|ref|YP_006464570.1|
Domain Number 1 Region: 211-400
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.54e-69
Family B3/B4 domain of PheRS, PheT 0.00000544
Further Details:      
 
Domain Number 2 Region: 473-694
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.19e-46
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00016
Further Details:      
 
Domain Number 3 Region: 36-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.69e-39
Family Myf domain 0.0039
Further Details:      
 
Domain Number 4 Region: 702-800
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.57e-30
Family Anticodon-binding domain of PheRS 0.0003
Further Details:      
 
Domain Number 5 Region: 410-481
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.65e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392423576|ref|YP_006464570.1|
Sequence length 801
Comment phenylalanyl-tRNA synthetase, beta subunit [Desulfosporosinus acidiphilus SJ4]
Sequence
MKVSMEWLRQLVDVDQNAEELAETLTRGGIEVENVENLSKGFEKVVIGEISSLTKHPDAD
RLWVCDVNVGEGKVTIVTGAQNLQEGDKIPVAMIGAVLPNDLSIRKSKLRGVVSEGMLCS
REELLLDNSVGLARSEGGILVLPPDAPLGENFGKYLGREDSVLDLELYPNRPDCLAMVNV
AREVASLTGKQPHLPKWADKTKGLDLPAAGDFQIIIEEEDLCWRYAALVVEDVHIGPSPE
WMQRRLKAAGVRPISNIVDITNYCMLEMGQPLHAFDRDKIKGNIHVRTAKAGEKLVTLDG
VERSLQTDTLLIADDREALGVAGVMGGFDSEITQETKRLLIESAHFSGVSVRRTSRRLGL
RSEASNRFEKGVNPYGCVATLGRVCELLIELGAGRPVALLDELKTLPPRRQISLSVEHTA
TVLGLELKNSDVRQVLENLNFKFEEKENLFNVEIPTYRADLEIEEDLMEEVARLRGYDLI
PTTLPQGDTTQGRRTAEQEFRRRLRRVLVQSGMDEVMTYTFTGAARDAQWGSAQHSIPLL
NPLREELSVMRTSLVPGLLEVAAKNVARRNTVVSIFEVGMTYWGEEKPLRRLPREVLQVA
GVAVGKSGRHWLNSAVQYDFYYLKGILEEIAQEFGLKFDYRVPEKRPLLHPGRSADIYLH
KECVGFLGELHPAQEKEWALEKAVLFELDLGALFKHMRPVVRAQSIPRFPAINRDLAVVV
SLETSAAAVMTRIRKLGGELLQNVEIFDVYTGKSIPEGRKSLAFSLRYQSLERTLTDEEV
NALNSRILEGIQQEFDAEWRK
Download sequence
Identical sequences I4D0B4
gi|392423576|ref|YP_006464570.1| WP_014825253.1.101568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]