SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392425563|ref|YP_006466557.1| from Desulfosporosinus acidiphilus SJ4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392425563|ref|YP_006466557.1|
Domain Number 1 Region: 8-295
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.75e-45
Family Methylenetetrahydrofolate reductase 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392425563|ref|YP_006466557.1|
Sequence length 524
Comment 5,10-methylenetetrahydrofolate reductase [Desulfosporosinus acidiphilus SJ4]
Sequence
MENKFKESLLDKNTLSVTWELVPGRGANEKAQEVAITSAEQAAKGGRVHALTITDNPGGN
PAILADNLGMEILNLGIEPLVHFTCKDKNRNQMESQLYALDRANVRNLLVMTGDYPVSGF
QGRPKPVFDLDPINTLQLISEMNKGLEIQGMKGPIFQKPSDFFAGAAVSPFKAAEAEQMV
QYYKMKKKIAGGAQFLVCQLGYDARKFHEVLQFLKVNNYDIPVVGNIYILPFGAARIMNQ
NQLPGCVVTDKLLAELDAEKGAPDKGVGARMLRAAKMYAIMKGMGFAGVHIGGHNIKYEQ
VEYIIDQGEDLSKNWQDYIREFDYPQPNGFYYFEKDEKTGLNTDRPANRANLPLDAPVNL
GYSMMRNMHALMFTPNKKLFPVMRSFYHAAEGKKKREKRLHALEHIAKVVMLDCKDCGDC
AMLDIAYLCPMSQCPKNQRNGACGGSFNGWCEVYPNEKKCIWVRAYARLKKYGEEANIDV
PPVPPANWDLYQTSSWSNFYLGKDHSAPILGIKRPESKVPQTKK
Download sequence
Identical sequences I4D601
WP_014827228.1.101568 gi|392425563|ref|YP_006466557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]