SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392425624|ref|YP_006466618.1| from Desulfosporosinus acidiphilus SJ4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392425624|ref|YP_006466618.1|
Domain Number 1 Region: 453-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000194
Family Anti-sigma factor antagonist SpoIIaa 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392425624|ref|YP_006466618.1|
Sequence length 609
Comment sulfate permease-like transporter, MFS superfamily [Desulfosporosinus acidiphilus SJ4]
Sequence
MNLTRFRYIPIIGTLKNYKKEYFTKDLIAALTVAVVAIPQSMAYALIAGVNPVYGLYTAI
ISSILGSMFGSSKHLVTGPTNAICLLVAASMRNYMGLDNAYQMLFLMTLLVGALQMLYGI
IKLGKVINFVSHSVIVGFTAGAGVLIALGQLNTILSISIKNSAQLPTMEKLYYVLTHISQ
TNYYALGLGLLTIAIILICKKINKNLPGALIGIVIPILIIVMFGLDQKGVKLTGAIPSSL
PPFKMVQFSFDSLNKVFSGAVAISIIGLVEAISISKSIASTSRQKIDANQEFMGQGISNI
ISSFFQCFPSSGSFTRSAINYYNGAVTRMAAIMSGIVIAIVLLFFAPYAQYIPNPCLAGV
ILVTAYSLIDQEEIKRIVKLGKFSSDSLAMAITCLATILMPDLDYAIYSGIVISIILYLK
DTNKAPVRLFIPILEEDSRISRQELEVIDNKTDLLIIQLEGHLYFGSAFDLEQKLDNLVG
KAKLCILKMENVSSLDATAINALKIFIKSVKRYGGETIICGARPKINTILLKANLEKELE
RDYKFTLSEEEILNSVAITTENERTVLSCEKDNSVVNNFAYHLLQSVTNFNGGNSSNKKT
TYLENSSVN
Download sequence
Identical sequences I4D662
gi|392425624|ref|YP_006466618.1| WP_014827289.1.101568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]