SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392426244|ref|YP_006467238.1| from Desulfosporosinus acidiphilus SJ4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392426244|ref|YP_006467238.1|
Domain Number 1 Region: 7-95,222-437
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.77e-100
Family Bacterial dinuclear zinc exopeptidases 0.0015
Further Details:      
 
Domain Number 2 Region: 96-222
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.48e-33
Family Aminopeptidase/glucanase lid domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392426244|ref|YP_006467238.1|
Sequence length 440
Comment aspartyl aminopeptidase [Desulfosporosinus acidiphilus SJ4]
Sequence
MLRSIITEEEVQFASELLKFVEESPSSFHTVESIKKLLLPSGFQSLNLSEKWSLIPGGKY
FVTQNNSAIIAFIIGSGEPEDDGFHLIGTHTDSPTFRIKPLPEMSTEGYIKLNVETYGGP
ILNTWLDRPLSLAGRVILRGPSAFSPQIKLYCSEDPLLIIPNIAIHLNKKVNEGVELNRQ
KDLLPLLSQIQENLQKEGALIEHLADHFQCLQKDILDFDLFLYDKQPGCFVGLQQEYISC
GRLDDLAMVHAGTSALLNAKPALATQVLACFDNEECGSTSKQGANSPLLSHVLERILIAQ
KKGREDYFRALAQSFFISADMAHALHPNAGEKHDPSHHPLLNKGPVIKYSANQSYTTDAE
SAAIFSSLCRSIGIPVQKFVNRSDERGGSTIGPIINTHLNLRSVDIGNPILAMHSIRELG
GVKDHLAIKNVFAQFYERHE
Download sequence
Identical sequences I4D7Y2
gi|392426244|ref|YP_006467238.1| WP_014827899.1.101568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]