SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|526457216|ref|YP_008329071.1| from Burkholderia pseudomallei MSHR305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|526457216|ref|YP_008329071.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.44e-107
Family FMN-linked oxidoreductases 0.0000000021
Further Details:      
 
Domain Number 2 Region: 335-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.59e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000162
Further Details:      
 
Domain Number 3 Region: 464-522,558-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.07e-25
Family C-terminal domain of adrenodoxin reductase-like 0.0000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|526457216|ref|YP_008329071.1|
Sequence length 677
Comment flavin oxidoreductase / NADH oxidase family protein [Burkholderia pseudomallei MSHR305]
Sequence
MTTPFPHLLAPLDLGFTTLRNRVLMGSMHTGLEDSRKTLPRLADYFAERARGGVGLIVTG
GFAPNVAGWTKPFGGTLSTGAAARRHRVIPDAVHAHGGKIALQILHTGRYGYHPFAVAPT
RLKSPISPFTPHELSARGIERQIRAFVRCAQLAREAGYDGVEIMGSEGYLINQFISLHTN
KRTDEWGGSYANRMRLPVEIVERTREAVGRDFIIVYRLSMLDLIPDGSNWDEVVLLAKAV
ERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGEVGIPLVTTNRINRPEIAEQ
ILADGCADMVSMARPFLADAEFVKKAAEGRVDEINTCIGCNQACLDHAFKNQIASCLLNP
RACHETELNYTRAASAKRVAVIGAGPAGLACATVLAQRGHRVELFDAAAEIGGQFNMAKR
IPGKEEFHEALRYFARQIELAGVQLRLNRRVDAAELIAAGYDDVVLATGVAPRNPRIPGQ
DHPKVLTYIDVLARNKPVGERVAVIGAGGIGFDVSEFLVQDGESPALDLDAWKAEWGVTD
PALARGGVVRGEVAPPARRVTLLQRKATGLGKGLGKTTGWIHRATLKMKQVEMIGGVNYE
LIDDKGLHVTFGKERRDPTVIEADTIVLCAGQEPERALYEPLKAAGVRVHLIGGAELAAE
LDAKRAIDQGARLAARL
Download sequence
Identical sequences A0A0E1SGD0
WP_004525028.1.10290 WP_004525028.1.14356 WP_004525028.1.14557 WP_004525028.1.18471 WP_004525028.1.18669 WP_004525028.1.19401 WP_004525028.1.22779 WP_004525028.1.25138 WP_004525028.1.25265 WP_004525028.1.25728 WP_004525028.1.259 WP_004525028.1.27390 WP_004525028.1.28632 WP_004525028.1.33087 WP_004525028.1.37806 WP_004525028.1.40045 WP_004525028.1.45890 WP_004525028.1.52760 WP_004525028.1.55415 WP_004525028.1.55691 WP_004525028.1.55755 WP_004525028.1.56458 WP_004525028.1.5734 WP_004525028.1.60836 WP_004525028.1.61900 WP_004525028.1.62103 WP_004525028.1.63361 WP_004525028.1.63439 WP_004525028.1.63661 WP_004525028.1.66321 WP_004525028.1.67978 WP_004525028.1.70735 WP_004525028.1.82575 WP_004525028.1.8395 WP_004525028.1.85443 WP_004525028.1.86295 WP_004525028.1.89093 WP_004525028.1.91700 WP_004525028.1.95339 WP_004525028.1.9537 WP_004525028.1.97148 WP_004525028.1.98491 gi|526457216|ref|YP_008329071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]