SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|526458308|ref|YP_008328199.1| from Burkholderia pseudomallei MSHR305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|526458308|ref|YP_008328199.1|
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.35e-108
Family FMN-linked oxidoreductases 0.00000000112
Further Details:      
 
Domain Number 2 Region: 334-523
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.65e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000556
Further Details:      
 
Domain Number 3 Region: 463-521,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.97e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|526458308|ref|YP_008328199.1|
Sequence length 673
Comment flavin oxidoreductase / NADH oxidase family protein [Burkholderia pseudomallei MSHR305]
Sequence
MTFYPHLTAPLELGFTSLKNRVLMGSMHVGLEEAANGFERMAAFYAERARGEAGLIVTGG
IAPNERGRMMPGGSMLTTEEEAERHRIVTRAVHDAGGRIAMQILHFGRYAYHPALVAPSA
LKAPINTFTPHALSASEVDATIDDFARCAALAQYAGYDGVEIMGSEGYLINEFIAAHTNH
REDEWGGAYENRIRFPVEIVRRVRERVGTNFIIIYRLSMLDLVEGGSTLDEVIRLAQAIE
AAGATILNTGIGWHEARIPTIATKVPRAAYAWVTKRLVDRVGIPLVATNRINTPEIAEQL
LAEGYCDMVSMARPFLADAQFVRKAREGRADEINTCIGCNQACLDHIFSGRITSCLVNPR
ACHETELVIEPAERRKRIAVVGAGPAGLSFAVTAAERGHDVELFEASPEIGGQFNIAKKV
PGKEEFHETLRYFRRQLELRGVTLHLNTRADVARLAGGGFDEIVLATGVTPRRPDIEGIG
HARVMGYLDVLRDGKPVGASVAVIGAGGIGFDVSEYLTHTGESASVAPSTFYAQWGIDVD
YGARGGVRMPHVEAAPRNVHLLQRKASKVGDGLGKTTGWIHRTSLKARRVAMSSGVSYER
IDDAGLHVRIDGEPRTLAVDSVVVCAGQEPQRELYDGLRAAGCSVHLIGGAHVAAELDAK
RAILQGTTLAASI
Download sequence
Identical sequences A0A2K3EKF5 A0A2K3G604 A0A2K3H5W0 A0A2K3HKJ5
WP_017881769.1.11072 WP_017881769.1.16680 WP_017881769.1.22779 WP_017881769.1.25265 WP_017881769.1.30671 WP_017881769.1.55691 WP_017881769.1.55755 WP_017881769.1.63439 WP_017881769.1.66321 WP_017881769.1.69106 WP_017881769.1.85490 WP_017881769.1.89093 WP_017881769.1.97148 gi|526458308|ref|YP_008328199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]