SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374992849|ref|YP_004968348.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374992849|ref|YP_004968348.1|
Domain Number 1 Region: 11-231
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.28e-56
Family PP-loop ATPase 0.0000995
Further Details:      
 
Domain Number 2 Region: 377-457
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.66e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 215-309
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000262
Family MesJ substrate recognition domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374992849|ref|YP_004968348.1|
Sequence length 470
Comment tRNA(Ile)-lysidine synthetase [Desulfosporosinus orientis DSM 765]
Sequence
MYDQLCKTILPRLIPNGTKVLVAVSGGPDSMALSHILWRYAREEGHRGISIILTHVHHGV
RKESDDEVTLVQNMAKLWDLPCRVHRFDAKGYAKTVGRSFQEAARAWRYDRWKEDMVEEG
CSLLATAHHLGDQAETILFRLLRGSGTAGLGGMYPCKGSIIRPLLGFTKADILQYCKREG
IPFALDHSNEEPIYARNRIRLELLPELEKNYNSRIQEVLGRTGELLRWDEEYFIGQVNAA
WKRYFFLDSQGDVCLRIEVFDEPAAILSRLLRKAAMQVTGEPRGMGFAYITKIMNSQGKL
GWVQDLPGLRVKIITEGLQFRSDKTTTMTEQAWIEAEIPLKLGCWEEIPNLKEKIGLWKD
EDLDSFCIGNESKIAVFGPKLAEQSLLCRTRRKGDKMWFRGVGHKSLKKVFQEAKIEDNA
RHKIPLIACGSEVLWIPGVRQSGQYPAEDNEEKLYCILTQQTVRSNLDSL
Download sequence
Identical sequences G7W7G2
gi|374992849|ref|YP_004968348.1| WP_014182662.1.78142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]