SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374992891|ref|YP_004968390.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374992891|ref|YP_004968390.1|
Domain Number 1 Region: 208-403
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.75e-70
Family B3/B4 domain of PheRS, PheT 0.0000052
Further Details:      
 
Domain Number 2 Region: 473-690
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.19e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00017
Further Details:      
 
Domain Number 3 Region: 35-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.14e-39
Family Myf domain 0.0034
Further Details:      
 
Domain Number 4 Region: 702-800
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.96e-28
Family Anticodon-binding domain of PheRS 0.00028
Further Details:      
 
Domain Number 5 Region: 410-481
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.86e-18
Family Domains B1 and B5 of PheRS-beta, PheT 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374992891|ref|YP_004968390.1|
Sequence length 801
Comment phenylalanyl-tRNA synthetase subunit beta [Desulfosporosinus orientis DSM 765]
Sequence
MKVSLEWLRELVDIEQSAEELAETLTRGGIEVEDVENLNKGFEKVVIGEIISLTKHPDAD
RLLVCAVNVGQEELTIVTGAQNLQTGDRIPVALIGATLPNELSIRKSKLRGVASHGMLCS
REELLLDDTVGLERSADGILILPQDVVIGENVGSYLGRNDSVLDLELYPNRPDCLAMVNV
AREVASLTGKKPHLPKWAEPNQVLSLSQDTDFKIIIEDEELCWRYAGLVVEDVKIEPSPE
WMQRRLKAAGVRPISNIVDITNYVMLEMGQPLHAFDKDKIKGDIHVRSAHPEEKIVTLDN
VERTVQPNTLLIADDQQALAVAGVMGGLDSEVTEDTKRLVIESAHFSPVSVRRTSRRLGL
RSEASNRFEKGIDVSGIVATLGRVCDLLIVLGAGRLVGLVDEVKHIPSKRQVTLSTEHTS
TVLGIELTVGEIRQVLEDLNFEYNERDELFKVEIPSYRSDLEIEEDLMEEVARLIGYDRI
PTTLPQGNQTQGRRTPEQEFRRRLRNTLAQSGMDEVLTYTFTRAESDAQWGSAKHSIPLL
NPLREELGVMRTSLIPGLLDVAARNIARRNMDVSIFEIGNTYWGEERPLQKLPREELRVA
GVAVGKSERHWLSKPANYDFYYLKGIIEGLAQEFGLKLEYRLAENQSLLHPGRSTDIYLH
NQCVGFLGEIHPVLGKEWGFERGVVFELEVMALFARARQTVRAHSIPRFPAIQRDLAIVV
AAETSADAVMAKIRKLGGDLLQQVEIFDVYTGSPVPSDHKSLAFTLRYQSLERTLTDDEV
NLLNSRILEGIQQDFGAERRK
Download sequence
Identical sequences G7W503
WP_014182704.1.78142 gi|374992891|ref|YP_004968390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]