SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374994314|ref|YP_004969813.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374994314|ref|YP_004969813.1|
Domain Number - Region: 29-72
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0149
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374994314|ref|YP_004969813.1|
Sequence length 105
Comment hypothetical protein Desor_1654 [Desulfosporosinus orientis DSM 765]
Sequence
MATGVIKAGACGFTINVKAESGDNHKVKLEITSDCPNYQKIAAELQEVDAFQEIFNKLHM
GKVYETFAKYSPHPSCPGVSGIMKSIEVAASLALPQNASISVTRE
Download sequence
Identical sequences G7WEW9
WP_014184117.1.78142 gi|374994314|ref|YP_004969813.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]