SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374995087|ref|YP_004970586.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374995087|ref|YP_004970586.1|
Domain Number 1 Region: 111-200
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000915
Family B3/B4 domain of PheRS, PheT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374995087|ref|YP_004970586.1|
Sequence length 221
Comment hypothetical protein Desor_2512 [Desulfosporosinus orientis DSM 765]
Sequence
MDFFVNEAGDTAKCSIGILVMENIQSVSSEDKLMLVKQEFEDTIRSKYGQATRGELKALH
PMDAYVSYYKKFGYTYHVLPQLESVIKGKTIPSGLPLVEAMFMAELKNMLLTASHDLDKI
KAPLSLKISTGSESFTTLNGHNVKTIPCDIMIADQEAVISTILRGPDMRTAITEHTTRVI
YTVYAPFGVEEQLVCEHLRDIESYVRILSEESVACLNQFIK
Download sequence
Identical sequences G7WGJ4
WP_014184879.1.78142 gi|374995087|ref|YP_004970586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]