SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374996263|ref|YP_004971762.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374996263|ref|YP_004971762.1|
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0075
Family YheA-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374996263|ref|YP_004971762.1|
Sequence length 80
Comment bacteriocin [Desulfosporosinus orientis DSM 765]
Sequence
MSTESARKFIERLKTDEGFNSKIRECHTAEERMTLAKEAGFSFTPEEIKEIRKEQLSDSE
LDAVAGAGCRENLFCDSLYY
Download sequence
Identical sequences G7W9B0
WP_014186055.1.78142 gi|374996263|ref|YP_004971762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]