SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374997212|ref|YP_004972711.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374997212|ref|YP_004972711.1|
Domain Number 1 Region: 4-282
Classification Level Classification E-value
Superfamily Folate-binding domain 1.4e-106
Family Aminomethyltransferase folate-binding domain 0.000000223
Further Details:      
 
Domain Number 2 Region: 274-365
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.29e-26
Family Aminomethyltransferase beta-barrel domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374997212|ref|YP_004972711.1|
Sequence length 373
Comment glycine cleavage system T protein [Desulfosporosinus orientis DSM 765]
Sequence
MVEAKRTPLYEEHLAAKAKLIDFGGWEMPVQYAGVIDEHHTVRTKAGLFDVSHMGEIDVH
GEEALAFVQMLITNDVTKIEDGKILYSPMCYPSGGIVDDLLVYRYDSQRFLLVVNASNTD
KDFAWIKDQAKNFQVETENISDQYAQLALQGPLAETILQRISSADLSQIHYYYFAHGEID
GVNCLISRTGYTGEDGFEIYVSPEYARQLWRKILEDGAGEGVQPIGLGARDTLRFEARLP
LYGNELGAEISPLEAGLGIFVKLDKADFIGREALLAQKEQGVPRKLVGLEMIDRGIARSH
YPLQKDGEEIGFVTSGSFSPTLNKNIALGLIRSDLAIQGEIINVMIRGKAVKAKIIPSLF
YKRGSQQLLSSIA
Download sequence
Identical sequences G7WHA6
gi|374997212|ref|YP_004972711.1| WP_014187003.1.78142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]