SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374997460|ref|YP_004972959.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374997460|ref|YP_004972959.1|
Domain Number 1 Region: 80-649
Classification Level Classification E-value
Superfamily Urocanase 3.66e-221
Family Urocanase 0.0000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374997460|ref|YP_004972959.1|
Sequence length 671
Comment urocanate hydratase [Desulfosporosinus orientis DSM 765]
Sequence
MSSNYDISQAMTVKLDPELPEMPEFVEGIRRAPDRGYSLSLDQTKIALKNALRYVPEELH
EQLAPEFLEELKTRGRIYAYRFRPAGKLSGKPIDEYKGNCIEGKAFQVMIDNNLDFDVAL
YPYELVTYGETGSVCQNWLQYRLIKKYLEVMTDHQTLVMESGHPVGLFPSRPESPRVIIT
NALMVGMFDNQKDWEIAEQMGVANYGQMTAGGWMYIGPQGIVHGTFNTLLNAGRMKLGIP
NDGDLQGTLFISSGLGGMSGAQGKSVEIARGVGIIAEVDESRIKTRYEQGWVSRVSSDLE
EVFRIAAESMEKKEPMSIAYQGNVVDLLEYAVDHNIKVDLLSDQTSCHVAYEGGYCPQGI
SFAERTRLLASDRDAFKRLVDKSLVRQFELIKTLVERGSYFFDYGNSFMKAVYDAGVMEI
SKNGVDEKDGFIFPSYVEDIMGPELFDYGYGPFRWVCLSGKPEDLRKTDAAAMSCIDPNR
RGQDRDNYIWIRDAEKNKLVVGTQARILYQDAEGRIRIALKFNEMIRKGEIGPVMLGRDH
HDVSGTDSPFRETANIKDGSNVMADMAVQSFAGDAARGMSMVSLHNGGGVGIGKAINGGF
GLVLDGSERVDNVIKSALLWDVVGGVARRAWARNEHSIETGIEFNEKYKGLGHITVPFIP
KDELIDRVVGK
Download sequence
Identical sequences G7WJK7
WP_014187248.1.78142 gi|374997460|ref|YP_004972959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]