SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374994393|ref|YP_004969892.1| from Desulfosporosinus orientis DSM 765

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374994393|ref|YP_004969892.1|
Domain Number 1 Region: 453-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374994393|ref|YP_004969892.1|
Sequence length 603
Comment sulfate permease [Desulfosporosinus orientis DSM 765]
Sequence
MYLSRFKYMPLIGTIGNYKKEYFSKDLIAALTVAVVVIPQSMAYALIAGVNPVYGLYTAI
VSTIIASAFGSSNHAIAGPTNAIALLVAGSMAPYMAQENAYEMLFLMTFMVGILQILFGV
VKLGKVINFVSHSVVIGFTAGAGVLIGLGQLSTLLGMSIKGSSHMSTMEKFYYVITHLSQ
TNIYALGLGLMTMAIIIVCKKINNKLPGALIGIIIPIIFIILFSLDQKGVKLTGFIPSSL
PPFKMLVFDVSVVRNLFGGAVAISIIGLVEAIAISKSIATTSRQKIDANQEFIAQGLANA
GGSFFQCFAGSGSFTRSAINYQSGAVTRLAGMMSGVVVALVLLFFAPYAQYIPSPCLAGV
ILVIAYNMVDKKEIKHIIKAGKFKSDSLAMMATCIATIVLPHLDVAIYTGIAISIALYLK
DTNKAPMKILVPSEGINGSVIEKEVRAIKEKMDILIIQLEGNLFFGSAEDLQAKLDDLVD
KSKVFILRMKYVANIDLTALGVLKVFIRTVKESGGMIIFSGVKSEFSSLLMNTHMNSDVG
EDNIFMSENEIFASSTNALERARTIIGPDVRGQEADSASRKLQESKSILSISPDLESKNT
AAF
Download sequence
Identical sequences G7W601
WP_014184196.1.78142 gi|374994393|ref|YP_004969892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]