SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|59126|fgenesh1_pm.7_#_276 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|59126|fgenesh1_pm.7_#_276
Domain Number 1 Region: 835-1080
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.86e-71
Family Glutamine synthetase catalytic domain 0.0031
Further Details:      
 
Domain Number 2 Region: 745-832
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 6.67e-20
Family Glutamine synthetase, N-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|59126|fgenesh1_pm.7_#_276
Sequence length 1083
Sequence
MATPSKPNPGATPTHLTSSPRPSGGPMNRTISLKSPSTRTPSASGHGHPNQPASTQQYAT
PIGVTADNDNAISFSSPSALLLGAYPGISPSPAVHDALVGPGMNDSDIQALGMSGLKLGN
ARDNDEERRRHISEVVQLLRSRVAGRGVCREGIERLSDLERFESIWQDDNLNIAGSFVDL
EIDFYRGQNVVKDVSLKYATPEATEGERREEATAVLKRDLIQTPEDGHRGTWKSLDNFHK
NLQWLARHDKLSEEVNCFQAIEGLYESMKRLWSEEGTQRKYSGDNEHLCSGNLGRPSLHR
GGRIGLWLDYWVPRARVLDVKQQKSPDLMALDNPPKYPANEETDYTNGDWKIAVECEEGY
PSLRVSKDWIGPDAFTVVHNDAEATSSTNPPESDVTVVNWTDPPATLTDNQGTSENMDLD
SGMLGSSSPNRRFVARLEPPLDIPFMVADQVYRHLNTEMPQDYKMVTYDGLLAPGWSPLS
ATGALGPEDPTQIDRKRSRISVPSLDEEGKPCTKWHSYTFQPFESAGGRTLRDIPFSHPR
QLADILPTFRQYALLANIIRGTFPLAPTSDDQKSSDEEKYMTERHGDVTILSNENPNVKK
LNALLGLSQADGVGSDDLNVDVTLRTIGQAPMVMLLFTVDRPSSAKSSPEDVALTKASIS
FEIGINGRVSVVDATGLLDDENDTLDDANADGRTTSGSTNELRSKLAYVLETSQDIGVLV
EWVLRWAESSTNVSNTENLMKYMTLDQKGAVMAEYIWIDSNGGTRSKTKTLSKAPAGVDE
LPEWNFDGSSTSQAPGDNSDVYLRPCAIYPDPFRRGDNVLVLCETWDSDGTPNKFNYRHD
CNRLMETHAKEEFWFGLEQEYTLLGPDGWPYGWPKGGFPGAQGPYYCGVGTGKVYCRDIV
EAHYRACLYAGVKISGINAEVMPSQWEYQVGPCAGIEMGDHLWLSRFLLHRVAEEFGVKI
SFEPKPIKGEWNGAGLHTNVSTTATRSDGGMKAIESYMKKLEARHVEHIAVYGEGNEERL
TGRHETGNIDKFSYGVADRGGSIRIPRQVAKDGKGYFEDRRPASNADPYQITGIIAETLC
GGL
Download sequence
Identical sequences A0A1L9TE15
jgi|Aspsy1|59126|fgenesh1_pm.7_#_276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]