SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|185767|estExt_Genewise1.C_13_t20262 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|185767|estExt_Genewise1.C_13_t20262
Domain Number 1 Region: 6-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000503
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 69-109
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000198
Family Zn2/Cys6 DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|185767|estExt_Genewise1.C_13_t20262
Sequence length 683
Sequence
MDAGQFQCRVCFRRYKRREHLQRHSSSHTSDRPHRCAACDRTFQRTDVLRRHIRTCSGKE
PDGFQASGRRRSCNRCIRLKKACNSAQPCQRCLSQGVQCQYAAPTTTPGRKQSDASTIEL
PNPVDLDSDFASFERSLMPAPAFPLDLSDPPLGNLMPSPSDTPFFPAGLDYSSLSWQDFL
TMTSESETLRTPPMMDTDCVRSLRFLDKFTSNTGFVASFDCGTESQRASILSPALLGSAN
WLDNSLSLKTHQILLLVKEVVTIKPRNSAVSLDWSPVLEQICLEFFSPPNLRKYLEVYWS
IWHPNVNIVHRPSFDPVQAKPAVLATMALIGACVSPDPMDNENAQMWFNCVEELVFIDED
FNSDVSFSSGSLGAHRNKIQALQAAYMVCLYQTWEGNDASKRRVRRNRFATLVSTARDIG
IPMARHINYSQQARSEFDWMQFAVREEFVRLLTWIFLLDTAFTIFNNLPPRMVIKEMKIH
TAVPEACFQAMTADQCYEQIQIWLPSESLYWKISLCSAFQTLCKDTLEVGVRDGLAALGP
LNLFILTSAIHSLIFQYRNSWGSLQLLSPVHHALNNWKAVWQQFASSLVPGMSPHVTVNH
NDLQPENMWKRVGFCSYCPEYWLLANLMTDKLTARSSTGSCEMNELERVDDGPLDSILNK
YDQTSMRQVNDLILSLSDFRIAG
Download sequence
Identical sequences A0A1L9T5S9
jgi|Aspsy1|185767|estExt_Genewise1.C_13_t20262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]