SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|344720|CE129682_1053 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|344720|CE129682_1053
Domain Number 1 Region: 6-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000567
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 2 Region: 74-116
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000142
Family Zn2/Cys6 DNA-binding domain 0.0044
Further Details:      
 
Weak hits

Sequence:  jgi|Aspsy1|344720|CE129682_1053
Domain Number - Region: 592-627
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 0.0837
Family Bacterial fluorinating enzyme, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|344720|CE129682_1053
Sequence length 712
Sequence
MSEPSHSCPLCPASFRRQEHLERHRSCHRTDRPFACGFCQQAFKRTDVLQRHWRTCKARL
RAGADIPPAPIGHRPNKRQACGRCARLKKACNLKWPCGTCQTKGHECSYRDSRRKFEHAT
RSSSPNAVTTLGSPFNLSISDEFNLADTIDLDRPCTVPSDTLESLFNGNCTFDMIQYSPA
RSDPSQPPETLDTIRFGKFQFLDKFTNVTGFLNSFECMRVYEVKQLATVMADLALQDTDD
KDASATPISLDFLLIPPPTIEKPEPSRPFSGLLADGCTDCSSWLSDPLAGVTNELVCRLK
HTTTTPSLGSSITMTWSSLIESICVQFFSPPNIRRYLVYFWSFWYPNCPIIHKPTFNVHS
TPYTLLLAMLLIGASFAPDDATSQNAKLWFNSAEELVFADQHFRRAVVHGDGEEGFHLRR
EAVKALQGAYLICLLQNWEGDDKSKRRIRRSRFSMVTAMGRELGFSPGSHHKLQNEDGDW
ERFIAKEEFNRTLSYIFLLDTAFIIFHNTPPKVSVSELNFDPVCPERCFQATTATECFLL
LHDSDGSSPIEGLSITDIVSRICQETLGCGEKEYLAGVGKLNLFIIVSAFHTLLFHARNT
FAPDAAMLPIQHGLTNWKEIWNHHEMLEQGGTQLSSLSSLASPSECWKRTGFMEYAPEYW
TLAQAIITSVFTTPANESGFGLGLLLNRVDENGMGQLNRFIRWAANAGMARI
Download sequence
Identical sequences A0A1L9TZC5
jgi|Aspsy1|344720|CE129682_1053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]