SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|36362|fgenesh1_pg.16_#_131 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|36362|fgenesh1_pg.16_#_131
Domain Number 1 Region: 20-67
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000121
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 86-125
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000000877
Family Zn2/Cys6 DNA-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|36362|fgenesh1_pg.16_#_131
Sequence length 914
Sequence
MDEAFPATLEQISGDASVPSYQCSHCQRRFSRVDHLSRHVRTHTHEKPFTCGVCGKAFSR
NDLLKRHECRHASRRRIHQAKALSGLARRVSQACRACAISKVKCDDAKPCARCVKKNTLC
DYDWNASVESGQLDRQDSMEAALLDSQPGAAQAPIEPAIDSSLGLSAPTGPARPSDSGTI
TGQITPSLSPGLDNNVHDVSFDLDICGFQTNGSDAGFTEATLTYADFLKDLLGWDGQGDG
VPRPVAGDGQGNTNIWDQHLNIDQTFDELLSFPMSDFMSPVEEAEPSAPIAGLDCSGTRR
KVADRTSFEERAFVAGARAFEGSWLNWSPDSMDQPSIDQDEASLSLPHDWTKDKDSLPRD
PSLAQQHLTIADRERVLSTLLLFSDRRPLIRIATTFPGTQELESMLHGFLRHQLGDTFSW
FHVPTFSLPRIRDELLAALVAFGASLTHVEVIQKLGHAMADILRYSVIEQWRRDNSLSRD
LQLMQALHTITFLGVYSGDRCKMEIAESTSQPLITILRRARWLLSGHYAPIIPSFEDDEA
ANQRKWEAWVEQESVKRLVHQVYVLDANISMMNLTTPVMHFDEIHVPMPEPNQLWLAASA
SEWRARYLSQSRLSAQPTLCENALRLLTDRDLIPGDDPLVSSLYVLHGLWRVIWEHRRLQ
DLVMLAREQSPVPDSAPSSFGGGEKLVKALTKMSARIPETPNSTGTKMYEFVFLLEFLSM
TLHVPLNCLQAFAGKDGPKEAQRVCCLLQEWTPTKEARQAMWHGGQLLRAARQLPADKMR
DIKVVIVYQTSLAFWAYGTVHIARRKRDGCATPTLTNVTQLTRKPLVALDGMLTPNVRRF
ISLDEGLPYISDTNCREDENVDENKVKLLLRPSETMAVTIRVLRPHRQGSYPPLAESFSR
LMREIVRAAQAIGM
Download sequence
Identical sequences A0A1L9T259
jgi|Aspsy1|36362|fgenesh1_pg.16_#_131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]