SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|51442|fgenesh1_kg.18_#_19_#_Locus9551v1rpkm2.14 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|51442|fgenesh1_kg.18_#_19_#_Locus9551v1rpkm2.14
Domain Number 1 Region: 67-101
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000034
Family Zn2/Cys6 DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 9-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000484
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|51442|fgenesh1_kg.18_#_19_#_Locus9551v1rpkm2.14
Sequence length 389
Sequence
MNSEPFICRFPHCRASYRRKEHRRRHEAQHSQNQVFKCTTCGQEFGRRDTLRRHMRKVHG
ITEPALIKHACTGCRVQKARCEGGPPCSNCLRRGIQCSLWCQNAEVQQIGHVRSPEAAIS
HNAPAESNRSGSGKERRYVDLYFKLFHPYWPFIHQGSFREYDDAPLLIQSINVIGLWLSN
EDNAQSRAIALHDVLSSAIHEQTEQWDASNSEGACSSCFWPIPTYQAILLHIIFAILYKG
GGGVLGLDLKPCLSPADTNLLDGLVESCKRLGMLHYPNMLARYCDSDLPAYVWVSIEEVK
RFNIALYRVCKLCSEQRSGTADCDIIRGSRRRLRAQDLQFPLPRNTRLWNAVDKAGWEYA
ATEDVFRHRLDDTMKDEWISNSALVLEMC
Download sequence
Identical sequences A0A1L9T014
jgi|Aspsy1|51442|fgenesh1_kg.18_#_19_#_Locus9551v1rpkm2.14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]