SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|54483|fgenesh1_pm.1_#_1526 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|54483|fgenesh1_pm.1_#_1526
Domain Number 1 Region: 8-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000177
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 2 Region: 73-116
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000427
Family Zn2/Cys6 DNA-binding domain 0.0031
Further Details:      
 
Weak hits

Sequence:  jgi|Aspsy1|54483|fgenesh1_pm.1_#_1526
Domain Number - Region: 245-319
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.035
Family Cullin repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|54483|fgenesh1_pm.1_#_1526
Sequence length 664
Sequence
MEQAGPPVLTCSVCSETFRRAEHLKRHTLTHIDDRPHACLFCDSRYKRTDALRRHWKTCP
QRVASGIQIPKRSLSGRRKQACHQCTSRKRACSAAQPCSECVLQVTECTYHGAQARRPSE
TSGTRREPDLLAGSGQSRRQRQKTSSKNDDVNSHTQNERVSQTRFDFLLNFTKATGLNEA
YNYAPKAEISSPDNAYFDNSASGSFPFEDSTASNPFSCYLDEVEASLWRDTQRSERHVSS
LMVDKATQLWQLLQPMLESRVSNHLEPNSLELVGFFSPQNLTRYLDLFWSRWYQHCPIIH
RATFDLENCWILLFATMSLIGACMSPQQSDHQAAKQLLDVVEELIFSNPLFSEIAFAGTR
KDDQSATRQNVETLQAACFMCLLQKWEGSDSAKLRMQRHRFTSFVATARAMGLSQATHRG
VTIGTGLNDAQWREWILKEEMIRTFNHIFLLDSAFVIFHNSDPRMVLQEMTIDLTCPEAV
FQASTPDEFMVAIKSHPARLRLTPPLLTDCIRTLCADHPDPAILAHIHSESALNLFTFAT
AIHGLIFHQLRAFSPLPLATGPLKRALDRWENAWTSSTEILSYSNSPSNDNQECAFPHRA
REFALLARAHIEKSHLSTEEWNAMVKNLPEHVSRGPGEHLATFDQTDMDPVAGLILAVEH
LDLK
Download sequence
Identical sequences A0A1L9U0F2
jgi|Aspsy1|54483|fgenesh1_pm.1_#_1526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]